PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma30g00140.1
Common NameZOSMA_30G00140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 300aa    MW: 34051.4 Da    PI: 6.6791
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma30g00140.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.21.2e-072482812154
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      k +yp+++++++L +++gL+ +q+ +WF N+R +
  Zosma30g00140.1 248 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 281
                      469*****************************87 PP

2ELK26.31.7e-09202223122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK +L++++++++ ++++E++
  Zosma30g00140.1 202 ELKIELKQGFRSRIEDVREEIL 223
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.0E-173781IPR005540KNOX1
PfamPF037903.1E-153980IPR005540KNOX1
SMARTSM012562.1E-1592147IPR005541KNOX2
PfamPF037913.1E-1397146IPR005541KNOX2
PROSITE profilePS512139.184202222IPR005539ELK domain
PROSITE profilePS5007111.758222285IPR001356Homeobox domain
SuperFamilySSF466894.02E-16224289IPR009057Homeodomain-like
SMARTSM003895.1E-11224289IPR001356Homeobox domain
CDDcd000864.01E-11225286No hitNo description
Gene3DG3DSA:1.10.10.602.7E-25229287IPR009057Homeodomain-like
PfamPF059201.0E-17242281IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MMMPPGGGGS GGGGSGGGED HHRKHELLQQ QEYEIMKLLK SEIAVHPLCE QLLSAHIGCL  60
RVATPIDHLP LIDAQLAQSQ HLLRSYASNH RNILSSQDKH ELHNVLGQYV LVLCSFKEQL  120
QNHVRVHAVE AVSACREIEQ SLHDLTGVTL EEGTGTTMSE DEEEIQMDYG NDESGDVNDM  180
MGFGPLLPTE SERTLMDRVR QELKIELKQG FRSRIEDVRE EILRKRRAGK LPGDTTSVLK  240
QWWQQHSKWP YPTEDDKAKL VEETGLQLKQ INNWFINQRK RNWHNNSNSV TSLKSKRKR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1278298RKRNWHNNSNSVTSLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010933995.11e-163PREDICTED: homeobox protein knotted-1-like 3 isoform X1
SwissprotQ94LW31e-154KNOS3_ORYSJ; Homeobox protein knotted-1-like 3
TrEMBLA0A0K9P9I10.0A0A0K9P9I1_Z
STRINGGSMUA_Achr1P03660_0011e-157(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-143KNOTTED-like homeobox of Arabidopsis thaliana 7